| Class b: All beta proteins [48724] (110 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.5: E set domains [49208] (25 proteins) |
| Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49249] (2 PDB entries) |
| Domain d1nfib_: 1nfi B: [21925] Other proteins in same PDB: d1nfia1, d1nfia2, d1nfic1, d1nfic2, d1nfie_, d1nfif_ |
PDB Entry: 1nfi (more details), 2.7 Å
SCOP Domain Sequences for d1nfib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfib_ b.1.1.5 (B:) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Human (Homo sapiens)}
snlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhr
qfaivfktpkykdinitkpasvfvqlrrksdletsepkpflyypeik
Timeline for d1nfib_: