Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.5: E set domains [49208] (24 proteins) |
Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49249] (2 PDB entries) |
Domain d1nfib_: 1nfi B: [21925] Other proteins in same PDB: d1nfia1, d1nfia2, d1nfic1, d1nfic2, d1nfie_, d1nfif_ |
PDB Entry: 1nfi (more details), 2.7 Å
SCOP Domain Sequences for d1nfib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfib_ b.1.1.5 (B:) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Human (Homo sapiens)} snlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhr qfaivfktpkykdinitkpasvfvqlrrksdletsepkpflyypeik
Timeline for d1nfib_: