Lineage for d1svcp1 (1svc P:251-353)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2038586Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 2038587Species Human (Homo sapiens) [TaxId:9606] [49249] (3 PDB entries)
    Uniprot P25799 245-350
  8. 2038588Domain d1svcp1: 1svc P:251-353 [21924]
    Other proteins in same PDB: d1svcp2
    protein/DNA complex

Details for d1svcp1

PDB Entry: 1svc (more details), 2.6 Å

PDB Description: nfkb p50 homodimer bound to dna
PDB Compounds: (P:) protein (nuclear factor kappa-b (nf-kb))

SCOPe Domain Sequences for d1svcp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svcp1 b.1.18.1 (P:251-353) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
lkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqf
aivfktpkykdinitkpasvfvqlrrksdletsepkpflyype

SCOPe Domain Coordinates for d1svcp1:

Click to download the PDB-style file with coordinates for d1svcp1.
(The format of our PDB-style files is described here.)

Timeline for d1svcp1: