SCOP 1.75: Domain d1svcp1: 1svc P:251-353

Lineage for d1svcp1 (1svc P:251-353)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49249] (9 PDB entries)
   Uniprot P25799 245-350

8. Domain d1svcp1: 1svc P:251-353 [21924]
   Other proteins in same PDB: d1svcp2
   protein/DNA complex; mutant

Details for d1svcp1

PDB Entry: 1svc, 2.6 Å

PDB Description: nfkb p50 homodimer bound to dna

PDB Compounds: (P:) protein (nuclear factor kappa-b (nf-kb))

SCOP Domain Sequences for d1svcp1:

Sequence; same for both SEQRES and ATOM records:

>d1svcp1 b.1.18.1 (P:251-353) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
lkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqf
aivfktpkykdinitkpasvfvqlrrksdletsepkpflyype

Timeline for d1svcp1:

• d1svcp1 first appeared (with stable ids) in SCOP 1.55
  
• d1svcp1 appears in SCOP 1.73
  
• d1svcp1 appears in SCOPe 2.01
  
• d1svcp1 appears in the current release, SCOPe 2.08