Lineage for d4b0cc_ (4b0c C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187851Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2187862Protein automated matches [191220] (4 species)
    not a true protein
  7. 2187863Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193354] (7 PDB entries)
  8. 2187908Domain d4b0cc_: 4b0c C: [219239]
    automated match to d4b0jt_
    complexed with c9h

Details for d4b0cc_

PDB Entry: 4b0c (more details), 2.7 Å

PDB Description: Crystal Structure of 3-hydroxydecanoyl-Acyl Carrier Protein Dehydratase (FabA) from Pseudomonas aeruginosa in complex with 3-(pentylthio)-4H-1,2,4-triazole
PDB Compounds: (C:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d4b0cc_:

Sequence, based on SEQRES records: (download)

>d4b0cc_ d.38.1.2 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglftstd

Sequence, based on observed residues (ATOM records): (download)

>d4b0cc_ d.38.1.2 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtinlvlaiadgtvsvdgreiysaeglrvglftstd

SCOPe Domain Coordinates for d4b0cc_:

Click to download the PDB-style file with coordinates for d4b0cc_.
(The format of our PDB-style files is described here.)

Timeline for d4b0cc_: