Lineage for d1a02n1 (1a02 N:577-678)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2038649Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 2038650Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)
  8. 2038657Domain d1a02n1: 1a02 N:577-678 [21923]
    Other proteins in same PDB: d1a02f_, d1a02j_, d1a02n2
    protein/DNA complex

Details for d1a02n1

PDB Entry: 1a02 (more details), 2.7 Å

PDB Description: structure of the dna binding domains of nfat, fos and jun bound to dna
PDB Compounds: (N:) nuclear factor of activated t cells

SCOPe Domain Sequences for d1a02n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a02n1 b.1.18.1 (N:577-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
lpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpn
mlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOPe Domain Coordinates for d1a02n1:

Click to download the PDB-style file with coordinates for d1a02n1.
(The format of our PDB-style files is described here.)

Timeline for d1a02n1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a02n2