SCOP 1.73: Domain d1a02n1: 1a02 N:577-678

Lineage for d1a02n1 (1a02 N:577-678)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)

8. Domain d1a02n1: 1a02 N:577-678 [21923]
   Other proteins in same PDB: d1a02f_, d1a02j_, d1a02n2
   mutant

Details for d1a02n1

PDB Entry: 1a02, 2.7 Å

PDB Description: structure of the dna binding domains of nfat, fos and jun bound to dna

PDB Compounds: (N:) nuclear factor of activated t cells

SCOP Domain Sequences for d1a02n1:

Sequence; same for both SEQRES and ATOM records:

>d1a02n1 b.1.18.1 (N:577-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
lpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpn
mlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

Timeline for d1a02n1:

• d1a02n1 first appeared (with stable ids) in SCOP 1.55
  
• d1a02n1 appears in SCOP 1.71
  
• d1a02n1 appears in SCOP 1.75
  
• d1a02n1 appears in the current release, SCOPe 2.08