Lineage for d1a02n1 (1a02 N:577-678)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 551985Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 552049Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 552050Species Human (Homo sapiens) [TaxId:9606] [49247] (4 PDB entries)
  8. 552055Domain d1a02n1: 1a02 N:577-678 [21923]
    Other proteins in same PDB: d1a02f_, d1a02j_, d1a02n2
    mutant

Details for d1a02n1

PDB Entry: 1a02 (more details), 2.7 Å

PDB Description: structure of the dna binding domains of nfat, fos and jun bound to dna

SCOP Domain Sequences for d1a02n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a02n1 b.1.18.1 (N:577-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens)}
lpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpn
mlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOP Domain Coordinates for d1a02n1:

Click to download the PDB-style file with coordinates for d1a02n1.
(The format of our PDB-style files is described here.)

Timeline for d1a02n1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a02n2