SCOP 1.61: Domain d1a02n1: 1a02 N:577-678

Lineage for d1a02n1 (1a02 N:577-678)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Transcription factor NFATC, C-terminal domain [49246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49247] (1 PDB entry)

8. Domain d1a02n1: 1a02 N:577-678 [21923]
   Other proteins in same PDB: d1a02f_, d1a02j_, d1a02n2

Details for d1a02n1

PDB Entry: 1a02, 2.7 Å

PDB Description: structure of the dna binding domains of nfat, fos and jun bound to dna

SCOP Domain Sequences for d1a02n1:

Sequence; same for both SEQRES and ATOM records:

>d1a02n1 b.1.1.5 (N:577-678) Transcription factor NFATC, C-terminal domain {Human (Homo sapiens)}
lpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpn
mlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

Timeline for d1a02n1:

• d1a02n1 first appeared (with stable ids) in SCOP 1.55
  
• d1a02n1 appears in SCOP 1.59
  
• d1a02n1 appears in SCOP 1.63
  
• d1a02n1 appears in the current release, SCOPe 2.08