Lineage for d1a02n1 (1a02 N:577-678)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9761Protein Transcription factor NFATC, C-terminal domain [49246] (1 species)
  7. 9762Species Human (Homo sapiens) [TaxId:9606] [49247] (1 PDB entry)
  8. 9763Domain d1a02n1: 1a02 N:577-678 [21923]
    Other proteins in same PDB: d1a02f_, d1a02j_, d1a02n2

Details for d1a02n1

PDB Entry: 1a02 (more details), 2.7 Å

PDB Description: structure of the dna binding domains of nfat, fos and jun bound to dna

SCOP Domain Sequences for d1a02n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a02n1 b.1.1.5 (N:577-678) Transcription factor NFATC, C-terminal domain {Human (Homo sapiens)}
lpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpn
mlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOP Domain Coordinates for d1a02n1:

Click to download the PDB-style file with coordinates for d1a02n1.
(The format of our PDB-style files is described here.)

Timeline for d1a02n1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a02n2