SCOPe 2.06: Domain d4azoa1: 4azo A:1-134

Lineage for d4azoa1 (4azo A:1-134)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226737] (4 PDB entries)

8. Domain d4azoa1: 4azo A:1-134 [219227]
   Other proteins in same PDB: d4azoa2
   automated match to d1b56a_
   complexed with cl

Details for d4azoa1

PDB Entry: 4azo, 2.33 Å

PDB Description: murine epidermal fatty acid-binding protein (fabp5), apo form, poly- his tag removed

PDB Compounds: (A:) fatty acid-binding protein, epidermal

SCOPe Domain Sequences for d4azoa1:

Sequence; same for both SEQRES and ATOM records:

>d4azoa1 b.60.1.2 (A:1-134) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
maslkdlegkwrlmeshgfeeymkelgvglalrkmaamakpdciitcdgnnitvktestv
kttvfscnlgekfeettadgrktetvctfqdgalvqhqqwdgkestitrklkdgkmivec
vmnnatctrvyekv

Timeline for d4azoa1:

• d4azoa1 first appeared in SCOPe 2.03, called d4azoa_
  
• d4azoa1 was called d4azoa_ in SCOPe 2.05
  
• d4azoa1 appears in SCOPe 2.07
  
• d4azoa1 appears in the current release, SCOPe 2.08