Lineage for d4aznb_ (4azn B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324658Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1324891Protein automated matches [190295] (5 species)
    not a true protein
  7. 1324945Species Mouse (Mus musculus) [TaxId:10090] [226737] (4 PDB entries)
  8. 1324950Domain d4aznb_: 4azn B: [219226]
    automated match to d1b56a_

Details for d4aznb_

PDB Entry: 4azn (more details), 2.51 Å

PDB Description: Murine epidermal fatty acid-binding protein (FABP5), apo form, poly- his tag-mediated crystal packing
PDB Compounds: (B:) fatty acid-binding protein, epidermal

SCOPe Domain Sequences for d4aznb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aznb_ b.60.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
shmaslkdlegkwrlmeshgfeeymkelgvglalrkmaamakpdciitcdgnnitvktes
tvkttvfscnlgekfeettadgrktetvctfqdgalvqhqqwdgkestitrklkdgkmiv
ecvmnnatctrvyekvq

SCOPe Domain Coordinates for d4aznb_:

Click to download the PDB-style file with coordinates for d4aznb_.
(The format of our PDB-style files is described here.)

Timeline for d4aznb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4azna_