Lineage for d4azmb_ (4azm B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1800288Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1800547Protein automated matches [190295] (6 species)
    not a true protein
  7. 1800563Species Human (Homo sapiens) [TaxId:9606] [187133] (24 PDB entries)
  8. 1800602Domain d4azmb_: 4azm B: [219224]
    automated match to d1b56a_
    complexed with gol, t4b

Details for d4azmb_

PDB Entry: 4azm (more details), 2.75 Å

PDB Description: human epidermal fatty acid-binding protein (fabp5) in complex with the inhibitor bms-309413
PDB Compounds: (B:) fatty acid-binding protein, epidermal

SCOPe Domain Sequences for d4azmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4azmb_ b.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestlk
ttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvecv
mnnvtctriyekve

SCOPe Domain Coordinates for d4azmb_:

Click to download the PDB-style file with coordinates for d4azmb_.
(The format of our PDB-style files is described here.)

Timeline for d4azmb_: