SCOPe 2.05: Domain d4azkb_: 4azk B:

Lineage for d4azkb_ (4azk B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)

7. Species Bacillus alcalophilus [TaxId:1445] [117697] (12 PDB entries)
   Uniprot Q9RME2

8. Domain d4azkb_: 4azk B: [219222]
   automated match to d1w23a_
   complexed with cl, plp

Details for d4azkb_

PDB Entry: 4azk, 1.6 Å

PDB Description: structural basis of l-phosphoserine binding to bacillus alcalophilus phosphoserine aminotransferase

PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d4azkb_:

Sequence; same for both SEQRES and ATOM records:

>d4azkb_ c.67.1.4 (B:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]}
qvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrellq
ipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaast
kansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsrpl
kvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpptf
siymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvtfn
lrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena

Timeline for d4azkb_:

• d4azkb_ first appeared in SCOPe 2.03
  
• d4azkb_ appears in SCOPe 2.04
  
• d4azkb_ appears in SCOPe 2.06
  
• d4azkb_ appears in the current release, SCOPe 2.08