SCOPe 2.05: Domain d4ayub_: 4ayu B:

Lineage for d4ayub_ (4ayu B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
   automatically mapped to Pfam PF00354

6. Protein Serum amyloid P component (SAP) [49952] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)

8. Domain d4ayub_: 4ayu B: [219215]
   automated match to d1saca_
   complexed with ca, gol, n8p, nag

Details for d4ayub_

PDB Entry: 4ayu, 1.5 Å

PDB Description: structure of n-acetyl-d-proline bound to serum amyloid p component

PDB Compounds: (B:) serum amyloid p-component

SCOPe Domain Sequences for d4ayub_:

Sequence; same for both SEQRES and ATOM records:

>d4ayub_ b.29.1.5 (B:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

Timeline for d4ayub_:

• d4ayub_ first appeared in SCOPe 2.03
  
• d4ayub_ appears in SCOPe 2.04
  
• d4ayub_ appears in SCOPe 2.06
  
• d4ayub_ appears in the current release, SCOPe 2.08