Lineage for d4ayha_ (4ayh A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2073009Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
    bacterial metal-binding, lipocalin-like protein
    automatically mapped to Pfam PF09223
  6. 2073024Protein automated matches [196992] (1 species)
    not a true protein
  7. 2073025Species Salmonella enterica [TaxId:440534] [196993] (3 PDB entries)
  8. 2073028Domain d4ayha_: 4ayh A: [219213]
    automated match to d4arha_
    complexed with so4, zn

Details for d4ayha_

PDB Entry: 4ayh (more details), 2.52 Å

PDB Description: The X-ray structure of zinc bound ZinT
PDB Compounds: (A:) Metal-binding protein yodA

SCOPe Domain Sequences for d4ayha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ayha_ b.60.1.4 (A:) automated matches {Salmonella enterica [TaxId: 440534]}
apmteveqkaaagvfddanvrdraltdwdgmwqsvypylvsgeldpvfrqkakkdpektf
edikayyrkgyvtnvetigiengviefhrdnnvasckynyagykiltyasgkkgvrylfe
ckdanskapkyvqfsdhiiaprksahfhifmgntsqqallqemenwptyypyqlkanevv
demlhh

SCOPe Domain Coordinates for d4ayha_:

Click to download the PDB-style file with coordinates for d4ayha_.
(The format of our PDB-style files is described here.)

Timeline for d4ayha_: