SCOPe 2.03: Domain d4ayha_: 4ayh A:

Lineage for d4ayha_ (4ayh A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
   bacterial metal-binding, lipocalin-like protein
   automatically mapped to Pfam PF09223

6. Protein automated matches [196992] (1 species)
   not a true protein

7. Species Salmonella enterica [TaxId:440534] [196993] (3 PDB entries)

8. Domain d4ayha_: 4ayh A: [219213]
   automated match to d4arha_
   complexed with so4, zn

Details for d4ayha_

PDB Entry: 4ayh, 2.52 Å

PDB Description: The X-ray structure of zinc bound ZinT

PDB Compounds: (A:) Metal-binding protein yodA

SCOPe Domain Sequences for d4ayha_:

Sequence; same for both SEQRES and ATOM records:

>d4ayha_ b.60.1.4 (A:) automated matches {Salmonella enterica [TaxId: 440534]}
apmteveqkaaagvfddanvrdraltdwdgmwqsvypylvsgeldpvfrqkakkdpektf
edikayyrkgyvtnvetigiengviefhrdnnvasckynyagykiltyasgkkgvrylfe
ckdanskapkyvqfsdhiiaprksahfhifmgntsqqallqemenwptyypyqlkanevv
demlhh

Timeline for d4ayha_:

• d4ayha_ is new in SCOPe 2.03-stable
  
• d4ayha_ appears in SCOPe 2.04
  
• d4ayha_ appears in the current release, SCOPe 2.08