Lineage for d1ayrd1 (1ayr D:1-182)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1112207Family b.1.18.11: Arrestin/Vps26-like [81291] (1 protein)
  6. 1112208Protein Arrestin [49244] (2 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 1112220Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
  8. 1112235Domain d1ayrd1: 1ayr D:1-182 [21921]

Details for d1ayrd1

PDB Entry: 1ayr (more details), 3.3 Å

PDB Description: arrestin from bovine rod outer segments
PDB Compounds: (D:) arrestin

SCOPe Domain Sequences for d1ayrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayrd1 b.1.18.11 (D:1-182) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
pr

SCOPe Domain Coordinates for d1ayrd1:

Click to download the PDB-style file with coordinates for d1ayrd1.
(The format of our PDB-style files is described here.)

Timeline for d1ayrd1: