![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) ![]() |
![]() | Family c.23.8.0: automated matches [191522] (1 protein) not a true family |
![]() | Protein automated matches [190879] (8 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226812] (3 PDB entries) |
![]() | Domain d4ay3b_: 4ay3 B: [219206] automated match to d3rg8c_ complexed with act |
PDB Entry: 4ay3 (more details), 1.76 Å
SCOPe Domain Sequences for d4ay3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ay3b_ c.23.8.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags tnagllaaqilgsfhddihdalelrreaiekdvregselv
Timeline for d4ay3b_: