SCOPe 2.07: Domain d4ay0a1: 4ay0 A:13-130

Lineage for d4ay0a1 (4ay0 A:13-130)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.0: automated matches [227286] (1 protein)
   not a true family

6. Protein automated matches [227104] (3 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226808] (1 PDB entry)

8. Domain d4ay0a1: 4ay0 A:13-130 [219201]
   Other proteins in same PDB: d4ay0a2, d4ay0b2
   automated match to d1l4ia1

Details for d4ay0a1

PDB Entry: 4ay0, 1.52 Å

PDB Description: High resolution crystal structure of the monomeric subunit-free Caf1M chaperone

PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4ay0a1:

Sequence, based on SEQRES records:

>d4ay0a1 b.1.11.0 (A:13-130) automated matches {Yersinia pestis [TaxId: 632]}
gvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrlda
kqqnslriaqaggvfprdkeslkwlcvkgippkdediwvdvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records):

>d4ay0a1 b.1.11.0 (A:13-130) automated matches {Yersinia pestis [TaxId: 632]}
gvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrlda
kqqnslriaqaggvfprdkeslkwlcvkgippncikllvrpnel

Timeline for d4ay0a1:

• d4ay0a1 first appeared in SCOPe 2.03
  
• d4ay0a1 appears in SCOPe 2.06
  
• d4ay0a1 appears in the current release, SCOPe 2.08