Lineage for d4ay0a1 (4ay0 A:13-130)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374559Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2374686Family b.1.11.0: automated matches [227286] (1 protein)
    not a true family
  6. 2374687Protein automated matches [227104] (3 species)
    not a true protein
  7. 2374699Species Yersinia pestis [TaxId:632] [226808] (1 PDB entry)
  8. 2374700Domain d4ay0a1: 4ay0 A:13-130 [219201]
    Other proteins in same PDB: d4ay0a2, d4ay0b2
    automated match to d1l4ia1

Details for d4ay0a1

PDB Entry: 4ay0 (more details), 1.52 Å

PDB Description: High resolution crystal structure of the monomeric subunit-free Caf1M chaperone
PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4ay0a1:

Sequence, based on SEQRES records: (download)

>d4ay0a1 b.1.11.0 (A:13-130) automated matches {Yersinia pestis [TaxId: 632]}
gvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrlda
kqqnslriaqaggvfprdkeslkwlcvkgippkdediwvdvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records): (download)

>d4ay0a1 b.1.11.0 (A:13-130) automated matches {Yersinia pestis [TaxId: 632]}
gvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrlda
kqqnslriaqaggvfprdkeslkwlcvkgippncikllvrpnel

SCOPe Domain Coordinates for d4ay0a1:

Click to download the PDB-style file with coordinates for d4ay0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ay0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ay0a2