Lineage for d4axsa_ (4axs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138062Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2138063Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2138216Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2138217Protein automated matches [190728] (15 species)
    not a true protein
  7. 2138282Species Mycoplasma penetrans [TaxId:28227] [226488] (1 PDB entry)
  8. 2138283Domain d4axsa_: 4axs A: [219198]
    automated match to d1e19a_
    complexed with so4

Details for d4axsa_

PDB Entry: 4axs (more details), 2.5 Å

PDB Description: Structure of Carbamate Kinase from Mycoplasma penetrans
PDB Compounds: (A:) carbamate kinase

SCOPe Domain Sequences for d4axsa_:

Sequence, based on SEQRES records: (download)

>d4axsa_ c.73.1.0 (A:) automated matches {Mycoplasma penetrans [TaxId: 28227]}
rivialggnalgdnpsqqkelvkipaakiaaliqeghevivghgngpqvgmifnafadak
kanektalvpfaeaggmsqgyigyhmltaisnelkklniqkdvlyfltqtivdandpafk
nptkpvgpfysskeiaeannpnsvivedagrgfrkvvaspipvdfigidaikqnvnngcv
civgggggiptiiqdnqyigvdgvidkdfalakiadavnadifvvltavdyvyvdfnkpt
qkalktvdvkalnnfinqdqfakgsmlpkikaamgfvnghpnrsaiiadlskvedalkgl
sgtkiia

Sequence, based on observed residues (ATOM records): (download)

>d4axsa_ c.73.1.0 (A:) automated matches {Mycoplasma penetrans [TaxId: 28227]}
rivialggnalgdnpsqqkelvkipaakiaaliqeghevivghgngpqvgmifnafadak
kanektalvpfaeaggmsqgyigyhmltaisnelkklniqkdvlyfltqtivdandpafk
nptkpvgpfysnpnsvivkvvaspipvdfigidaikqnvnngcvcivgggggiptiiqdn
qyigvdgvidkdfalakiadavnadifvvltavdyvyvdfnkptqkalktvdvkalnnfi
nqdqfakgsmlpkikaamgfvnghpnrsaiiadlskvedalkglsgtkiia

SCOPe Domain Coordinates for d4axsa_:

Click to download the PDB-style file with coordinates for d4axsa_.
(The format of our PDB-style files is described here.)

Timeline for d4axsa_: