SCOPe 2.05: Domain d4axla_: 4axl A:

Lineage for d4axla_ (4axl A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)

8. Domain d4axla_: 4axl A: [219197]
   automated match to d3hd3b_
   complexed with act, gol, zn

Details for d4axla_

PDB Entry: 4axl, 1.92 Å

PDB Description: human cathepsin l apo form with zn

PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d4axla_:

Sequence; same for both SEQRES and ATOM records:

>d4axla_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Timeline for d4axla_:

• d4axla_ first appeared in SCOPe 2.03
  
• d4axla_ appears in SCOPe 2.04
  
• d4axla_ appears in SCOPe 2.06
  
• d4axla_ appears in the current release, SCOPe 2.08