SCOPe 2.06: Domain d4axkb1: 4axk B:2-246

Lineage for d4axkb1 (4axk B:2-246)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein automated matches [190186] (10 species)
   not a true protein

7. Species Corynebacterium efficiens [TaxId:152794] [226694] (1 PDB entry)

8. Domain d4axkb1: 4axk B:2-246 [219196]
   Other proteins in same PDB: d4axka2, d4axkb2
   automated match to d2y85a_
   complexed with gol

Details for d4axkb1

PDB Entry: 4axk, 2.25 Å

PDB Description: crystal structure of subhisa from the thermophile corynebacterium efficiens

PDB Compounds: (B:) 1-(5-phosphoribosyl)-5-((5'-phosphoribosylamino) methylideneamino)imidazole-4-carboxamide isomerase

SCOPe Domain Sequences for d4axkb1:

Sequence, based on SEQRES records:

>d4axkb1 c.1.2.1 (B:2-246) automated matches {Corynebacterium efficiens [TaxId: 152794]}
tftilpavdvvngqavrldqgeagteksygtplesalrwqeqgaewlhfvdldaafnrgs
nhelmaeitrqldikveltggirddasleralatgatrvnigtaalekpewiadvirrhg
ekiavdiavrlengewrtkgngwvsdggdlwevlerldsqgcsrfvvtdvskdgtltgpn
vdllrdvaaatdapivasggistledvlglakyqdegidsviigkalyehrftlaealea
veklg

Sequence, based on observed residues (ATOM records):

>d4axkb1 c.1.2.1 (B:2-246) automated matches {Corynebacterium efficiens [TaxId: 152794]}
tftilpavdvvngqavrldqgeagteksygtplesalrwqeqgaewlhfvdldaafnrgs
nhelmaeitrqldikveltggirddasleralatgatrvnigtaalekpewiadvirrhg
ekiavdiavrlengewrtdlwevlerldsqgcsrfvvtdvskdgtltgpnvdllrdvaaa
tdapivasggistledvlglakyqdegidsviigkalyehrftlaealeaveklg

Timeline for d4axkb1:

• d4axkb1 first appeared in SCOPe 2.03, called d4axkb_
  
• d4axkb1 was called d4axkb_ in SCOPe 2.05
  
• d4axkb1 appears in SCOPe 2.07
  
• d4axkb1 appears in the current release, SCOPe 2.08