SCOPe 2.05: Domain d4axkb_: 4axk B:

Lineage for d4axkb_ (4axk B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein automated matches [190186] (9 species)
   not a true protein

7. Species Corynebacterium efficiens [TaxId:152794] [226694] (1 PDB entry)

8. Domain d4axkb_: 4axk B: [219196]
   automated match to d2y85a_
   complexed with gol

Details for d4axkb_

PDB Entry: 4axk, 2.25 Å

PDB Description: crystal structure of subhisa from the thermophile corynebacterium efficiens

PDB Compounds: (B:) 1-(5-phosphoribosyl)-5-((5'-phosphoribosylamino) methylideneamino)imidazole-4-carboxamide isomerase

SCOPe Domain Sequences for d4axkb_:

Sequence, based on SEQRES records:

>d4axkb_ c.1.2.1 (B:) automated matches {Corynebacterium efficiens [TaxId: 152794]}
tftilpavdvvngqavrldqgeagteksygtplesalrwqeqgaewlhfvdldaafnrgs
nhelmaeitrqldikveltggirddasleralatgatrvnigtaalekpewiadvirrhg
ekiavdiavrlengewrtkgngwvsdggdlwevlerldsqgcsrfvvtdvskdgtltgpn
vdllrdvaaatdapivasggistledvlglakyqdegidsviigkalyehrftlaealea
veklgklaa

Sequence, based on observed residues (ATOM records):

>d4axkb_ c.1.2.1 (B:) automated matches {Corynebacterium efficiens [TaxId: 152794]}
tftilpavdvvngqavrldqgeagteksygtplesalrwqeqgaewlhfvdldaafnrgs
nhelmaeitrqldikveltggirddasleralatgatrvnigtaalekpewiadvirrhg
ekiavdiavrlengewrtdlwevlerldsqgcsrfvvtdvskdgtltgpnvdllrdvaaa
tdapivasggistledvlglakyqdegidsviigkalyehrftlaealeaveklgklaa

Timeline for d4axkb_:

• d4axkb_ first appeared in SCOPe 2.03
  
• d4axkb_ appears in SCOPe 2.04
  
• d4axkb_ is called d4axkb1 in SCOPe 2.06
  
• d4axkb_ appears in the current release, SCOPe 2.08, called d4axkb1