Lineage for d4axkb_ (4axk B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337251Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 1337284Protein automated matches [190186] (4 species)
    not a true protein
  7. 1337285Species Corynebacterium efficiens [TaxId:152794] [226694] (1 PDB entry)
  8. 1337287Domain d4axkb_: 4axk B: [219196]
    automated match to d2y85a_
    complexed with gol

Details for d4axkb_

PDB Entry: 4axk (more details), 2.25 Å

PDB Description: crystal structure of subhisa from the thermophile corynebacterium efficiens
PDB Compounds: (B:) 1-(5-phosphoribosyl)-5-((5'-phosphoribosylamino) methylideneamino)imidazole-4-carboxamide isomerase

SCOPe Domain Sequences for d4axkb_:

Sequence, based on SEQRES records: (download)

>d4axkb_ c.1.2.1 (B:) automated matches {Corynebacterium efficiens [TaxId: 152794]}
tftilpavdvvngqavrldqgeagteksygtplesalrwqeqgaewlhfvdldaafnrgs
nhelmaeitrqldikveltggirddasleralatgatrvnigtaalekpewiadvirrhg
ekiavdiavrlengewrtkgngwvsdggdlwevlerldsqgcsrfvvtdvskdgtltgpn
vdllrdvaaatdapivasggistledvlglakyqdegidsviigkalyehrftlaealea
veklgklaa

Sequence, based on observed residues (ATOM records): (download)

>d4axkb_ c.1.2.1 (B:) automated matches {Corynebacterium efficiens [TaxId: 152794]}
tftilpavdvvngqavrldqgeagteksygtplesalrwqeqgaewlhfvdldaafnrgs
nhelmaeitrqldikveltggirddasleralatgatrvnigtaalekpewiadvirrhg
ekiavdiavrlengewrtdlwevlerldsqgcsrfvvtdvskdgtltgpnvdllrdvaaa
tdapivasggistledvlglakyqdegidsviigkalyehrftlaealeaveklgklaa

SCOPe Domain Coordinates for d4axkb_:

Click to download the PDB-style file with coordinates for d4axkb_.
(The format of our PDB-style files is described here.)

Timeline for d4axkb_: