SCOP 1.73: Domain d1ayrc1: 1ayr C:1-182

Lineage for d1ayrc1 (1ayr C:1-182)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (20 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.11: Arrestin [81291] (1 protein)
Protein Arrestin [49244] (2 species)
duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
Domain d1ayrc1: 1ayr C:1-182 [21919]

Details for d1ayrc1

PDB Entry: 1ayr (more details), 3.3 Å

PDB Description: arrestin from bovine rod outer segments

PDB Compounds: (C:) arrestin

SCOP Domain Sequences for d1ayrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayrc1 b.1.18.11 (C:1-182) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
pr

SCOP Domain Coordinates for d1ayrc1:

Click to download the PDB-style file with coordinates for d1ayrc1.
(The format of our PDB-style files is described here.)

Timeline for d1ayrc1: