Lineage for d4ax4a1 (4ax4 A:1-430)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066277Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2066278Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 protein domains)
    automatically mapped to Pfam PF02897
  6. 2066308Protein automated matches [226977] (2 species)
    not a true protein
  7. 2066311Species Pig (Sus scrofa) [TaxId:9823] [226475] (1 PDB entry)
  8. 2066312Domain d4ax4a1: 4ax4 A:1-430 [219189]
    Other proteins in same PDB: d4ax4a2
    automated match to d1e5ta1
    complexed with gol; mutant

Details for d4ax4a1

PDB Entry: 4ax4 (more details), 1.6 Å

PDB Description: prolyl oligopeptidase from porcine brain, h680a mutant
PDB Compounds: (A:) prolyl oligopeptidase

SCOPe Domain Sequences for d4ax4a1:

Sequence, based on SEQRES records: (download)

>d4ax4a1 b.69.7.1 (A:1-430) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

Sequence, based on observed residues (ATOM records): (download)

>d4ax4a1 b.69.7.1 (A:1-430) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynayptstnlhqklyyhvlgtdqsedilcaefpdepkwmggaelsddgryvlls
iregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvftfktnrhspn
yrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvkntlqlhdlatga
llkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeeleprvfrevtvkgi

SCOPe Domain Coordinates for d4ax4a1:

Click to download the PDB-style file with coordinates for d4ax4a1.
(The format of our PDB-style files is described here.)

Timeline for d4ax4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ax4a2