SCOPe 2.07: Domain d4awqa_: 4awq A:

Lineage for d4awqa_ (4awq A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries)

8. Domain d4awqa_: 4awq A: [219184]
   automated match to d4awpb_
   complexed with 592

Details for d4awqa_

PDB Entry: 4awq, 1.6 Å

PDB Description: complex of hsp90 atpase domain with tropane derived inhibitors

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d4awqa_:

Sequence, based on SEQRES records:

>d4awqa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve

Sequence, based on observed residues (ATOM records):

>d4awqa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqdismigqfgvgfy
saylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqteyle
errikeivkkhsqfigypitlfve

Timeline for d4awqa_:

• d4awqa_ first appeared in SCOPe 2.03
  
• d4awqa_ appears in SCOPe 2.06
  
• d4awqa_ appears in the current release, SCOPe 2.08