SCOPe 2.08: Domain d4awoa_: 4awo A:

Lineage for d4awoa_ (4awo A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries)

8. Domain d4awoa_: 4awo A: [219182]
   automated match to d4awpb_
   complexed with 99b

Details for d4awoa_

PDB Entry: 4awo, 1.7 Å

PDB Description: Complex of HSP90 ATPase domain with tropane derived inhibitors

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d4awoa_:

Sequence, based on SEQRES records:

>d4awoa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfvek

Sequence, based on observed residues (ATOM records):

>d4awoa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqdismigqfgvgfy
saylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqteyle
errikeivkkhsqfigypitlfvek

Timeline for d4awoa_:

• d4awoa_ first appeared in SCOPe 2.03
  
• d4awoa_ appears in SCOPe 2.07