Lineage for d4awoa_ (4awo A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973575Species Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries)
  8. 2973601Domain d4awoa_: 4awo A: [219182]
    automated match to d4awpb_
    complexed with 99b

Details for d4awoa_

PDB Entry: 4awo (more details), 1.7 Å

PDB Description: Complex of HSP90 ATPase domain with tropane derived inhibitors
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d4awoa_:

Sequence, based on SEQRES records: (download)

>d4awoa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfvek

Sequence, based on observed residues (ATOM records): (download)

>d4awoa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqdismigqfgvgfy
saylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqteyle
errikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d4awoa_:

Click to download the PDB-style file with coordinates for d4awoa_.
(The format of our PDB-style files is described here.)

Timeline for d4awoa_: