SCOPe 2.04: Domain d1ayrb2: 1ayr B:183-363

Lineage for d1ayrb2 (1ayr B:183-363)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (24 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)
Protein Arrestin [49244] (3 species)
duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
Domain d1ayrb2: 1ayr B:183-363 [21918]

Details for d1ayrb2

PDB Entry: 1ayr (more details), 3.3 Å

PDB Description: arrestin from bovine rod outer segments

PDB Compounds: (B:) arrestin

SCOPe Domain Sequences for d1ayrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayrb2 b.1.18.11 (B:183-363) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
p

SCOPe Domain Coordinates for d1ayrb2:

Click to download the PDB-style file with coordinates for d1ayrb2.
(The format of our PDB-style files is described here.)

Timeline for d1ayrb2: