Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins) |
Protein Arrestin [49244] (3 species) duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head |
Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries) |
Domain d1ayrb2: 1ayr B:183-363 [21918] |
PDB Entry: 1ayr (more details), 3.3 Å
SCOPe Domain Sequences for d1ayrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayrb2 b.1.18.11 (B:183-363) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]} dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped p
Timeline for d1ayrb2: