SCOPe 2.08: Domain d4avyb_: 4avy B:

Lineage for d4avyb_ (4avy B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (30 PDB entries)

8. Domain d4avyb_: 4avy B: [219176]
   automated match to d1cyda_

Details for d4avyb_

PDB Entry: 4avy, 2 Å

PDB Description: The AEROPATH project and Pseudomonas aeruginosa high-throughput crystallographic studies for assessment of potential targets in early stage drug discovery.

PDB Compounds: (B:) Probable short-chain dehydrogenase

SCOPe Domain Sequences for d4avyb_:

Sequence; same for both SEQRES and ATOM records:

>d4avyb_ c.2.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mvfqhdiyagqqvlvtggssgigaaiamqfaelgaevvalgldadgvhaprhprirreel
ditdsqrlqrlfealprldvlvnnagisrdreeydlatfervlrlnlsaamlasqlarpl
laqrggsilniasmystfgsadrpaysaskgaivqltrslaceyaaerirvnaiapgwid
tplgaglkadveatrrimqrtplarwgeapevasaaaflcgpgasfvtgavlavdggylc
a

Timeline for d4avyb_:

• d4avyb_ first appeared in SCOPe 2.03
  
• d4avyb_ appears in SCOPe 2.07