SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4avyb_ (4avy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2095624Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (24 PDB entries)
  8. 2095630Domain d4avyb_: 4avy B: [219176]
    automated match to d1cyda_

Details for d4avyb_

PDB Entry: 4avy (more details), 2 Å

PDB Description: The AEROPATH project and Pseudomonas aeruginosa high-throughput crystallographic studies for assessment of potential targets in early stage drug discovery.
PDB Compounds: (B:) Probable short-chain dehydrogenase

SCOPe Domain Sequences for d4avyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4avyb_ c.2.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mvfqhdiyagqqvlvtggssgigaaiamqfaelgaevvalgldadgvhaprhprirreel
ditdsqrlqrlfealprldvlvnnagisrdreeydlatfervlrlnlsaamlasqlarpl
laqrggsilniasmystfgsadrpaysaskgaivqltrslaceyaaerirvnaiapgwid
tplgaglkadveatrrimqrtplarwgeapevasaaaflcgpgasfvtgavlavdggylc
a

SCOPe Domain Coordinates for d4avyb_:

Click to download the PDB-style file with coordinates for d4avyb_.
(The format of our PDB-style files is described here.)

Timeline for d4avyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4avya_