Lineage for d4avyb_ (4avy B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848075Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (30 PDB entries)
  8. 2848081Domain d4avyb_: 4avy B: [219176]
    automated match to d1cyda_

Details for d4avyb_

PDB Entry: 4avy (more details), 2 Å

PDB Description: The AEROPATH project and Pseudomonas aeruginosa high-throughput crystallographic studies for assessment of potential targets in early stage drug discovery.
PDB Compounds: (B:) Probable short-chain dehydrogenase

SCOPe Domain Sequences for d4avyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4avyb_ c.2.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mvfqhdiyagqqvlvtggssgigaaiamqfaelgaevvalgldadgvhaprhprirreel
ditdsqrlqrlfealprldvlvnnagisrdreeydlatfervlrlnlsaamlasqlarpl
laqrggsilniasmystfgsadrpaysaskgaivqltrslaceyaaerirvnaiapgwid
tplgaglkadveatrrimqrtplarwgeapevasaaaflcgpgasfvtgavlavdggylc
a

SCOPe Domain Coordinates for d4avyb_:

Click to download the PDB-style file with coordinates for d4avyb_.
(The format of our PDB-style files is described here.)

Timeline for d4avyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4avya_