SCOPe 2.08: Domain d4avxa2: 4avx A:148-223

Lineage for d4avxa2 (4avx A:148-223)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d4avxa2: 4avx A:148-223 [219174]
   Other proteins in same PDB: d4avxa1
   automated match to d1dvpa2
   complexed with edo, itp, zn

Details for d4avxa2

PDB Entry: 4avx, 1.68 Å

PDB Description: hepatocyte growth factor-regulated tyrosine kinase substrate (hgs-hrs) bound to an ip2 compound at 1.68 a resolution

PDB Compounds: (A:) hepatocyte growth factor-regulated tyrosine kinase substrate

SCOPe Domain Sequences for d4avxa2:

Sequence; same for both SEQRES and ATOM records:

>d4avxa2 g.50.1.0 (A:148-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdamfaaerapdwvdaeechrcrvqfgvmtrkhhcracgqifcgkcsskystipkfgiek
evrvcepcyeqlnrka

Timeline for d4avxa2:

• d4avxa2 first appeared in SCOPe 2.03
  
• d4avxa2 appears in SCOPe 2.07