Lineage for d4avve_ (4avv E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374229Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 protein domains)
    automatically mapped to Pfam PF00354
  6. 2374317Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 2374318Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. 2374338Domain d4avve_: 4avv E: [219172]
    automated match to d1saca_
    complexed with act, cd, ghe, nag, sia

Details for d4avve_

PDB Entry: 4avv (more details), 1.6 Å

PDB Description: Structure of CPHPC bound to Serum Amyloid P Component
PDB Compounds: (E:) serum amyloid p-component

SCOPe Domain Sequences for d4avve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4avve_ b.29.1.5 (E:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d4avve_:

Click to download the PDB-style file with coordinates for d4avve_.
(The format of our PDB-style files is described here.)

Timeline for d4avve_: