SCOPe 2.05: Domain d4avvb_: 4avv B:

Lineage for d4avvb_ (4avv B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
   automatically mapped to Pfam PF00354

6. Protein Serum amyloid P component (SAP) [49952] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)

8. Domain d4avvb_: 4avv B: [219169]
   automated match to d1saca_
   complexed with act, cd, ghe, nag, sia

Details for d4avvb_

PDB Entry: 4avv, 1.6 Å

PDB Description: structure of cphpc bound to serum amyloid p component

PDB Compounds: (B:) serum amyloid p-component

SCOPe Domain Sequences for d4avvb_:

Sequence; same for both SEQRES and ATOM records:

>d4avvb_ b.29.1.5 (B:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

Timeline for d4avvb_:

• d4avvb_ first appeared in SCOPe 2.03
  
• d4avvb_ appears in SCOPe 2.04
  
• d4avvb_ appears in SCOPe 2.06
  
• d4avvb_ appears in the current release, SCOPe 2.08