Lineage for d4avpd_ (4avp D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308186Species Human (Homo sapiens) [TaxId:9606] [186924] (22 PDB entries)
  8. 2308209Domain d4avpd_: 4avp D: [219167]
    automated match to d1duxc_
    complexed with edo

Details for d4avpd_

PDB Entry: 4avp (more details), 1.82 Å

PDB Description: crystal structure of the dna-binding domain of human etv1.
PDB Compounds: (D:) ets translocation variant 1

SCOPe Domain Sequences for d4avpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4avpd_ a.4.5.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpamnydklsrsl
ryyyekgimqkvageryvykfvcdpealfsmaf

SCOPe Domain Coordinates for d4avpd_:

Click to download the PDB-style file with coordinates for d4avpd_.
(The format of our PDB-style files is described here.)

Timeline for d4avpd_: