Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186924] (22 PDB entries) |
Domain d4avpc_: 4avp C: [219166] automated match to d1duxc_ complexed with edo |
PDB Entry: 4avp (more details), 1.82 Å
SCOPe Domain Sequences for d4avpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4avpc_ a.4.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpamnydklsrsl ryyyekgimqkvageryvykfvcdpealfsmaf
Timeline for d4avpc_: