SCOPe 2.03: Domain d4avma_: 4avm A:

Lineage for d4avma_ (4avm A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.0: automated matches [191660] (1 protein)
   not a true family

6. Protein automated matches [191240] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189695] (5 PDB entries)

8. Domain d4avma_: 4avm A: [219163]
   automated match to d1urua_
   complexed with edo, epe

Details for d4avma_

PDB Entry: 4avm, 1.91 Å

PDB Description: crystal structure of the n-bar domain of human bridging integrator 2.

PDB Compounds: (A:) bridging integrator 2

SCOPe Domain Sequences for d4avma_:

Sequence; same for both SEQRES and ATOM records:

>d4avma_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqvqkkfsraqekvlqklgkavetkderfeqsasnfyqqqaeghklykdlknflsavkvm
hesskrvsetlqeiyssewdgheelkaivwnndllwedyeekladqavrtmeiyvaqfse
ikeriakrgrklvdydsarhhleavqnakkkdeaktakaeeefnkaqtvfedlnqellee
lpilynsrigcyvtifqnisnlrdvfyremsklnhnlyevmsklerqhsn

Timeline for d4avma_:

• d4avma_ is new in SCOPe 2.03-stable
  
• d4avma_ appears in SCOPe 2.04
  
• d4avma_ appears in the current release, SCOPe 2.08