Class a: All alpha proteins [46456] (290 folds) |
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
Family a.238.1.0: automated matches [191660] (1 protein) not a true family |
Protein automated matches [191240] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189695] (6 PDB entries) |
Domain d4avma_: 4avm A: [219163] automated match to d1urua_ complexed with edo, epe |
PDB Entry: 4avm (more details), 1.91 Å
SCOPe Domain Sequences for d4avma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4avma_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kqvqkkfsraqekvlqklgkavetkderfeqsasnfyqqqaeghklykdlknflsavkvm hesskrvsetlqeiyssewdgheelkaivwnndllwedyeekladqavrtmeiyvaqfse ikeriakrgrklvdydsarhhleavqnakkkdeaktakaeeefnkaqtvfedlnqellee lpilynsrigcyvtifqnisnlrdvfyremsklnhnlyevmsklerqhsn
Timeline for d4avma_: