Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (26 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [226398] (2 PDB entries) |
Domain d4aubd_: 4aub D: [219155] automated match to d3n6qa_ complexed with flc, nap |
PDB Entry: 4aub (more details), 2.05 Å
SCOPe Domain Sequences for d4aubd_:
Sequence, based on SEQRES records: (download)
>d4aubd_ c.1.7.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]} wlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfdl annygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasldq slkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvell rewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltgkylngipqds rmhregnkvrgltpkmlteanlnslrllnemaqqrgqsmaqmalswllkddrvtsvliga sraeqleenvqalnnltfstkelaqidqhiadgel
>d4aubd_ c.1.7.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]} wlanperygqmqyrycgksglrlpalslglwhnfghvnalesqrailrkafdlgithfdl annygpppgsaeenfgrllredfaayrdeliistkagydmwpgpygsggsrkyllasldq slkrmgleyvdifyshrvdentpmeetasalahavqsgkalyvgissyspertqkmvell rewkipllihqpsynllnrwvdksglldtlqnngvgciaftplaqglltlteanlnslrl lnemaqqrgqsmaqmalswllkddrvtsvligasraeqleenvqalnnltfstkelaqid qhiadgel
Timeline for d4aubd_: