Lineage for d4auaa_ (4aua A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219260Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2219261Species Human (Homo sapiens) [TaxId:9606] [88860] (14 PDB entries)
  8. 2219264Domain d4auaa_: 4aua A: [219151]
    automated match to d3nuxa_
    complexed with 4au

Details for d4auaa_

PDB Entry: 4aua (more details), 2.31 Å

PDB Description: liganded x-ray crystal structure of cyclin dependent kinase 6 (cdk6)
PDB Compounds: (A:) cyclin-dependent kinase 6

SCOPe Domain Sequences for d4auaa_:

Sequence, based on SEQRES records: (download)

>d4auaa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
qqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhlet
fehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqll
rgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapev
llqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalp
rqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq

Sequence, based on observed residues (ATOM records): (download)

>d4auaa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
qqyecvaeigegagkvfkardlknggrfvalkrstirevavlrhletfehpnvvrlfdvc
tkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqni
lvtssgqikladfglatlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdv
dqlgkildviglpgeedwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnp
akrisaysalshpyfq

SCOPe Domain Coordinates for d4auaa_:

Click to download the PDB-style file with coordinates for d4auaa_.
(The format of our PDB-style files is described here.)

Timeline for d4auaa_: