SCOPe 2.05: Domain d4at6l2: 4at6 L:111-212

Lineage for d4at6l2 (4at6 L:111-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d4at6l2: 4at6 L:111-212 [219144]
   Other proteins in same PDB: d4at6b1, d4at6d1, d4at6f1, d4at6i1, d4at6k1, d4at6l1, d4at6n1, d4at6p1
   automated match to d1q0xl2

Details for d4at6l2

PDB Entry: 4at6, 2.55 Å

PDB Description: fab fragment of antiporphyrin antibody 14h7

PDB Compounds: (L:) fab 14h7 light chain

SCOPe Domain Sequences for d4at6l2:

Sequence; same for both SEQRES and ATOM records:

>d4at6l2 b.1.1.2 (L:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsra

Timeline for d4at6l2:

• d4at6l2 first appeared in SCOPe 2.03
  
• d4at6l2 appears in SCOPe 2.04
  
• d4at6l2 appears in SCOPe 2.06
  
• d4at6l2 appears in the current release, SCOPe 2.07