![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (9 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
![]() | Domain d4at6l2: 4at6 L:111-212 [219144] Other proteins in same PDB: d4at6b1, d4at6d1, d4at6f1, d4at6i1, d4at6k1, d4at6l1, d4at6n1, d4at6p1 automated match to d1q0xl2 |
PDB Entry: 4at6 (more details), 2.55 Å
SCOPe Domain Sequences for d4at6l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4at6l2 b.1.1.2 (L:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq snnkymassyltltarawerhssyscqvtheghtvekslsra
Timeline for d4at6l2: