SCOPe 2.02: Domain d1cf1d2: 1cf1 D:183-386

Lineage for d1cf1d2 (1cf1 D:183-386)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.11: Arrestin/Vps26-like [81291] (1 protein)

6. Protein Arrestin [49244] (2 species)
   duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head

7. Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)

8. Domain d1cf1d2: 1cf1 D:183-386 [21914]

Details for d1cf1d2

PDB Entry: 1cf1, 2.8 Å

PDB Description: arrestin from bovine rod outer segments

PDB Compounds: (D:) protein (arrestin)

SCOPe Domain Sequences for d1cf1d2:

Sequence, based on SEQRES records:

>d1cf1d2 b.1.18.11 (D:183-386) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
pdtakesfqdenfvfeefarqnlk

Sequence, based on observed residues (ATOM records):

>d1cf1d2 b.1.18.11 (D:183-386) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
enfvfeefarqnlk

Timeline for d1cf1d2:

• d1cf1d2 first appeared (with stable ids) in SCOP 1.55
  
• d1cf1d2 appears in SCOPe 2.01
  
• d1cf1d2 appears in SCOPe 2.03
  
• d1cf1d2 appears in the current release, SCOPe 2.08