SCOPe 2.08: Domain d4at6f1: 4at6 F:1-110

Lineage for d4at6f1 (4at6 F:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d4at6f1: 4at6 F:1-110 [219137]
   Other proteins in same PDB: d4at6b2, d4at6d2, d4at6f2, d4at6i2, d4at6k2, d4at6l2, d4at6m2, d4at6n2, d4at6o2, d4at6p2
   automated match to d1q0xl1

Details for d4at6f1

PDB Entry: 4at6, 2.55 Å

PDB Description: fab fragment of antiporphyrin antibody 14h7

PDB Compounds: (F:) fab 14h7 light chain

SCOPe Domain Sequences for d4at6f1:

Sequence; same for both SEQRES and ATOM records:

>d4at6f1 b.1.1.1 (F:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlg

Timeline for d4at6f1:

• d4at6f1 first appeared in SCOPe 2.03
  
• d4at6f1 appears in SCOPe 2.07