Lineage for d4at5a1 (4at5 A:543-838)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (31 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1194 PDB entries)
  8. 2546388Domain d4at5a1: 4at5 A:543-838 [219132]
    Other proteins in same PDB: d4at5a2
    automated match to d3gqia_
    complexed with gol, muj

Details for d4at5a1

PDB Entry: 4at5 (more details), 1.71 Å

PDB Description: crystal structure of trkb kinase domain in complex with gw2580
PDB Compounds: (A:) bdnf/nt-3 growth factors receptor

SCOPe Domain Sequences for d4at5a1:

Sequence, based on SEQRES records: (download)

>d4at5a1 d.144.1.0 (A:543-838) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dtfvqhikrhnivlkrelgegafgkvflaecynlcpeqdkilvavktlkdasdnarkdfh
reaelltnlqhehivkfygvcvegdplimvfeymkhgdlnkflrahgpdavlmaegnppt
eltqsqmlhiaqqiaagmvylasqhfvhrdlatrnclvgenllvkigdfgmsrdvystdy
yrvgghtmlpirwmppesimyrkfttesdvwslgvvlweiftygkqpwyqlsnnevieci
tqgrvlqrprtcpqevyelmlgcwqrephmrknikgihtllqnlakaspvyldilg

Sequence, based on observed residues (ATOM records): (download)

>d4at5a1 d.144.1.0 (A:543-838) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dtfvqhikrhnivlkrelgegafgkvflaecynlkilvavktlkdasdnarkdfhreael
ltnlqhehivkfygvcvegdplimvfeymkhgdlnkflrahgpdavlmaegnppteltqs
qmlhiaqqiaagmvylasqhfvhrdlatrnclvgenllvkigdfgmsrdvystdyyrvgg
htmlpirwmppesimyrkfttesdvwslgvvlweiftygkqpwyqlsnneviecitqgrv
lqrprtcpqevyelmlgcwqrephmrknikgihtllqnlakaspvyldilg

SCOPe Domain Coordinates for d4at5a1:

Click to download the PDB-style file with coordinates for d4at5a1.
(The format of our PDB-style files is described here.)

Timeline for d4at5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4at5a2