SCOPe 2.05: Domain d4aqpa_: 4aqp A:

Lineage for d4aqpa_ (4aqp A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.145: AXH domain [102030] (1 superfamily)
   pseudobarrel; some similarity to OB-fold

4. Superfamily b.145.1: AXH domain [102031] (2 families)
   automatically mapped to Pfam PF08517

5. Family b.145.1.1: AXH domain [102032] (2 proteins)

6. Protein automated matches [196747] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196748] (4 PDB entries)

8. Domain d4aqpa_: 4aqp A: [219112]
   automated match to d4apta_
   complexed with na, peg

Details for d4aqpa_

PDB Entry: 4aqp, 2.45 Å

PDB Description: The structure of the AXH domain of ataxin-1.

PDB Compounds: (A:) ataxin-1

SCOPe Domain Sequences for d4aqpa_:

Sequence; same for both SEQRES and ATOM records:

>d4aqpa_ b.145.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveriedshs
pgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvci
sltlk

Timeline for d4aqpa_:

• d4aqpa_ first appeared in SCOPe 2.03
  
• d4aqpa_ appears in SCOPe 2.04
  
• d4aqpa_ is called d4aqpa1 in SCOPe 2.06
  
• d4aqpa_ appears in the current release, SCOPe 2.08, called d4aqpa1