SCOPe 2.08: Domain d4aqpa1: 4aqp A:567-689

Lineage for d4aqpa1 (4aqp A:567-689)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.145: AXH domain [102030] (1 superfamily)
   pseudobarrel; some similarity to OB-fold

4. Superfamily b.145.1: AXH domain [102031] (2 families)
   automatically mapped to Pfam PF08517

5. Family b.145.1.1: AXH domain [102032] (2 proteins)

6. Protein automated matches [196747] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196748] (4 PDB entries)

8. Domain d4aqpa1: 4aqp A:567-689 [219112]
   Other proteins in same PDB: d4aqpa2, d4aqpb2, d4aqpc2, d4aqpd2
   automated match to d4apta_
   complexed with na, peg

Details for d4aqpa1

PDB Entry: 4aqp, 2.45 Å

PDB Description: The structure of the AXH domain of ataxin-1.

PDB Compounds: (A:) ataxin-1

SCOPe Domain Sequences for d4aqpa1:

Sequence; same for both SEQRES and ATOM records:

>d4aqpa1 b.145.1.1 (A:567-689) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveriedshspg
vaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvcisl
tlk

Timeline for d4aqpa1:

• d4aqpa1 first appeared in SCOPe 2.03, called d4aqpa_
  
• d4aqpa1 appears in SCOPe 2.07