SCOPe 2.08: Domain d4aqla1: 4aql A:9-75,A:389-450

Lineage for d4aqla1 (4aql A:9-75,A:389-450)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins)

6. Protein Guanine deaminase [159336] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159338] (2 PDB entries)
   Uniprot Q9Y2T3 8-75,389-451

8. Domain d4aqla1: 4aql A:9-75,A:389-450 [219110]
   Other proteins in same PDB: d4aqla2
   automated match to d2uz9a1
   complexed with txc, zn

Details for d4aqla1

PDB Entry: 4aql, 1.99 Å

PDB Description: human guanine deaminase in complex with valacyclovir

PDB Compounds: (A:) guanine deaminase

SCOPe Domain Sequences for d4aqla1:

Sequence; same for both SEQRES and ATOM records:

>d4aqla1 b.92.1.4 (A:9-75,A:389-450) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]}
lahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceirel
shheffmXfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieev
yvggkqvvpf

Timeline for d4aqla1:

• d4aqla1 first appeared in SCOPe 2.03
  
• d4aqla1 appears in SCOPe 2.07