Lineage for d1cf1b2 (1cf1 B:183-385)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032796Family b.1.18.11: Arrestin/Vps26-like [81291] (2 protein domains)
  6. 2032797Protein Arrestin [49244] (3 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 2032813Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
  8. 2032817Domain d1cf1b2: 1cf1 B:183-385 [21910]

Details for d1cf1b2

PDB Entry: 1cf1 (more details), 2.8 Å

PDB Description: arrestin from bovine rod outer segments
PDB Compounds: (B:) protein (arrestin)

SCOPe Domain Sequences for d1cf1b2:

Sequence, based on SEQRES records: (download)

>d1cf1b2 b.1.18.11 (B:183-385) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
pdtakesfqdenfvfeefarqnl

Sequence, based on observed residues (ATOM records): (download)

>d1cf1b2 b.1.18.11 (B:183-385) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
denfvfeefarqnl

SCOPe Domain Coordinates for d1cf1b2:

Click to download the PDB-style file with coordinates for d1cf1b2.
(The format of our PDB-style files is described here.)

Timeline for d1cf1b2: