Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (15 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [196877] (3 PDB entries) |
Domain d4aq2a_: 4aq2 A: [219098] automated match to d4aq6a_ complexed with b3p, fe |
PDB Entry: 4aq2 (more details), 1.95 Å
SCOPe Domain Sequences for d4aq2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aq2a_ b.82.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]} lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf npnrr
Timeline for d4aq2a_: